Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT10 Peptide - C-terminal region

GALNT10 Peptide - C-terminal region

Product Specifications

UniProt

Q86SR1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALNT10 Rabbit Polyclonal Antibody (orb580528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD43/Sialophorin Antibody (SPN/839) [HRP]
NBP2-47879H 0.1 mL

Mouse Monoclonal CD43/Sialophorin Antibody (SPN/839) [HRP]

Sign In for Pricing
View Details
Recombinant Human Down syndrome cell adhesion molecule (DSCAM) , partial
MBS1061676 Inquire

Recombinant Human Down syndrome cell adhesion molecule (DSCAM) , partial

Sign In for Pricing
View Details
GSTA1/2/5 (E-6) : m-IgG1 BP-HRP Bundle
sc-531769 1 Kit

GSTA1/2/5 (E-6) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Rabbit Monoclonal p63/TP73L Antibody (TP63/7807R) [Janelia Fluor 669]
NBP3-20792JF669 0.1 mL

Rabbit Monoclonal p63/TP73L Antibody (TP63/7807R) [Janelia Fluor 669]

Sign In for Pricing
View Details
SSXP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV786408 1.0 µg DNA

SSXP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
PGP9.5 Rabbit Monoclonal antibody
AMRe02432-01 1 Each

PGP9.5 Rabbit Monoclonal antibody

Sign In for Pricing
View Details