FCRL3 Peptide - middle region
FCRL3 Peptide - middle region
Product Specifications
UniProt
Q96P31
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FCRL3 Rabbit Polyclonal Antibody (orb581017) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details