Gtf2h2 Peptide - N-terminal region
Gtf2h2 Peptide - N-terminal region
Product Specifications
UniProt
Q8C5I2
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GTF2H2 Rabbit Polyclonal Antibody (orb581098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![EMA (MUC1) Mouse Monoclonal Antibody [Clone ID: SPM533]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd76e/imageurl/am50141pu-s.webp)
AM50141PU-S 100 µg
EMA (MUC1) Mouse Monoclonal Antibody [Clone ID: SPM533]
Sign In for Pricing
View Details 
