EME2 Peptide - middle region
EME2 Peptide - middle region
Product Specifications
UniProt
A4GXA9
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EME2 Rabbit Polyclonal Antibody (orb581376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001244299
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEVR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HP219727 200 Reactions
C9orf171 (CFAP77) Human qPCR Primer Pair (NM_207417)
Sign In for Pricing
View Details 
E-EL-M3071-01 24 Tests
Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit
Sign In for Pricing
View Details