Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EME2 Peptide - middle region

EME2 Peptide - middle region

Product Specifications

UniProt

A4GXA9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EME2 Rabbit Polyclonal Antibody (orb581376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001244299

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CERKL Human Gene Knockout Kit (CRISPR)
KN417772 1 Kit

CERKL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR2W3 Antibody
8G899-AAT 50 µg

OR2W3 Antibody

Sign In for Pricing
View Details
TDP43 (TARDBP) (NM_007375) Human Over-expression Lysate
LC402137 20 µg

TDP43 (TARDBP) (NM_007375) Human Over-expression Lysate

Sign In for Pricing
View Details
C130050O18Rik Mouse Gene Knockout Kit (CRISPR)
KN502335 1 Kit

C130050O18Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,2-Difluoroethylamine-d2 Hydrochloride
TRC-D445816-500MG 500 mg

2,2-Difluoroethylamine-d2 Hydrochloride

Sign In for Pricing
View Details
KCNC3 (317-328) Goat Polyclonal Antibody
AP31782PU-N 100 µg

KCNC3 (317-328) Goat Polyclonal Antibody

Sign In for Pricing
View Details