Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBT Peptide - N-terminal region

DBT Peptide - N-terminal region

Product Specifications

UniProt

Q5VVL7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DBT Rabbit Polyclonal Antibody (orb581530) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRK2 (E8Z7T) Mouse Monoclonal Antibody (BSA and Azide Free)
CST 39029SF 100 µg

LRRK2 (E8Z7T) Mouse Monoclonal Antibody (BSA and Azide Free)

Sign In for Pricing
View Details
Tas2r114 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3590105 3x 1.0 µg

Tas2r114 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus DNA-directed RNA polymerase subunit beta'(rpoC), partial
MBS1462686 Inquire

Recombinant Vibrio vulnificus DNA-directed RNA polymerase subunit beta'(rpoC), partial

Sign In for Pricing
View Details
RPS6KA1 Peptide - C-terminal region
MBS3246169-01 0.1 mg

RPS6KA1 Peptide - C-terminal region

Sign In for Pricing
View Details
RPS6KA1 Peptide - C-terminal region
MBS3246169-02 5x 0.1 mg

RPS6KA1 Peptide - C-terminal region

Sign In for Pricing
View Details
Epstein Barr Virus, Nuclear Antigen (Epstein-Barr Nuclear Antigen 1, EBV Nuclear Antigen 1, EBNA1, EBNA-1, EBV, BKRF1, Human Herpes virus 4, HHV4) (MaxLight 750) discontinued
E3440-11H-ML750 100 µL

Epstein Barr Virus, Nuclear Antigen (Epstein-Barr Nuclear Antigen 1, EBV Nuclear Antigen 1, EBNA1, EBNA-1, EBV, BKRF1, Human Herpes virus 4, HHV4) (MaxLight 750) discontinued

Sign In for Pricing
View Details