Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBT Peptide - N-terminal region

DBT Peptide - N-terminal region

Product Specifications

UniProt

Q5VVL7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DBT Rabbit Polyclonal Antibody (orb581530) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGR2 Recombinant Protein
OPCD01194-50UG 50 µg

AGR2 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)
MBS1105866-01 0.02 mg (E-Coli)

Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)
MBS1105866-02 0.02 mg (Yeast)

Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)
MBS1105866-03 0.1 mg (E-Coli)

Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)
MBS1105866-04 0.1 mg (Yeast)

Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)

Sign In for Pricing
View Details
Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)
MBS1105866-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus casei Glutamate--tRNA ligase (gltX)

Sign In for Pricing
View Details