CLK2 Peptide - N-terminal region
CLK2 Peptide - N-terminal region
Product Specifications
UniProt
B7Z8N6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CLK2 Rabbit Polyclonal Antibody (orb581537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC043388-500 1x 500 µL
CD43 (T-Cell Marker) (SPN/3388), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details