CLK2 Peptide - N-terminal region
CLK2 Peptide - N-terminal region
Product Specifications
UniProt
B7Z8N6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CLK2 Rabbit Polyclonal Antibody (orb581537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Cyclophilin B Recombinant Rabbit Monoclonal Antibody [ST05-22]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81f73/imageurl/et1609-58.webp)
ET1609-58 100 µL
Cyclophilin B Recombinant Rabbit Monoclonal Antibody [ST05-22]
Sign In for Pricing
View Details 
AP54150PU-N 400 µL
Tapasin Related Protein (TAPBPL) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
