Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHB Peptide - C-terminal region

EFHB Peptide - C-terminal region

Product Specifications

UniProt

Q8N7U6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFHB Rabbit Polyclonal Antibody (orb581820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Choline-13C2 (chloride)
OR1037236 1 Each

Choline-13C2 (chloride)

Sign In for Pricing
View Details
Lentiviral mouse Mllt10 shRNA (UAS) - Lentiviral mouse Mllt10 shRNA (UAS, iRFP) (25)
GTR15118790 1 Vial

Lentiviral mouse Mllt10 shRNA (UAS) - Lentiviral mouse Mllt10 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ZNF248 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV705930 1.0 µg DNA

ZNF248 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Monoclonal CD11b Antibody (238446) [Biotin]
FAB16991B 0.1 mL

Mouse Monoclonal CD11b Antibody (238446) [Biotin]

Sign In for Pricing
View Details
Kcnip1 (NM_022929) Rat Tagged Lenti ORF Clone
RR204611L4 10 µg

Kcnip1 (NM_022929) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PSD3 siRNA (h)
sc-77475 10 µM

PSD3 siRNA (h)

Sign In for Pricing
View Details