Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHB Peptide - C-terminal region

EFHB Peptide - C-terminal region

Product Specifications

UniProt

Q8N7U6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFHB Rabbit Polyclonal Antibody (orb581820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF503, NT (ZNF503, Zinc finger protein 503)
044256 200 µL

ZNF503, NT (ZNF503, Zinc finger protein 503)

Sign In for Pricing
View Details
FAM26E (h) -PR
sc-95307-PR 10 µM - 20 µL

FAM26E (h) -PR

Sign In for Pricing
View Details
Mouse Inhibitory Subunit Of NF Kappa B Alpha (IkBa) ELISA Kit
RD-IkBa-Mu-48Tests 48 Tests

Mouse Inhibitory Subunit Of NF Kappa B Alpha (IkBa) ELISA Kit

Sign In for Pricing
View Details
TNFSF9 Mouse Monoclonal Antibody [Clone ID: LBI3B6]
AMM21084VCF 100 µg

TNFSF9 Mouse Monoclonal Antibody [Clone ID: LBI3B6]

Sign In for Pricing
View Details
PLEKHA8P1 ORF Vector (Human) (pORF)
ORF027957 1.0 µg DNA

PLEKHA8P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
LOC54744 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV702962 1.0 µg DNA

LOC54744 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details