Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TENT5C Peptide - middle region

TENT5C Peptide - middle region

Product Specifications

Product Name Alternative

FAM46C

UniProt

Q5VWP2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060179.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antistasin-Related Peptide (D-Arg32) (Antistasin 32-38)
A2298-47 5 mg

Antistasin-Related Peptide (D-Arg32) (Antistasin 32-38)

Sign In for Pricing
View Details
GJB5 Antibody (Biotin)
orb350484-01 50 µg

GJB5 Antibody (Biotin)

Sign In for Pricing
View Details
GJB5 Antibody (Biotin)
orb350484-02 100 µg

GJB5 Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Treponema Pallidum rpsQ Protein (aa 1-84) (strain Nichols)
VAng-Cr1306-500gEcoli 500 µg (E. coli)

Recombinant Treponema Pallidum rpsQ Protein (aa 1-84) (strain Nichols)

Sign In for Pricing
View Details
MORC4 Human shRNA Plasmid Kit (Locus ID 79710)
TL303205 1 Kit

MORC4 Human shRNA Plasmid Kit (Locus ID 79710)

Sign In for Pricing
View Details
UBE2M Rabbit Polyclonal Antibody
orb3071625-01 30 µL

UBE2M Rabbit Polyclonal Antibody

Sign In for Pricing
View Details