TENT5C Peptide - middle region
TENT5C Peptide - middle region
Product Specifications
Product Name Alternative
FAM46C
UniProt
Q5VWP2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_060179.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS030001-100ug 100 µg
ERO1L (ERO1A) (NM_014584) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS648636-01 0.1 mg
COX6B2 (Cytochrome C Oxidase Subunit 6B2, Cancer/Testis Antigen 59, CT59, Cytochrome C Oxidase Subunit VIb Isoform 2, COX VIb-2, Cytochrome C Oxidase Subunit VIb, Testis-specific Isoform)
Sign In for Pricing
View Details MBS648636-02 5x 0.1 mg
COX6B2 (Cytochrome C Oxidase Subunit 6B2, Cancer/Testis Antigen 59, CT59, Cytochrome C Oxidase Subunit VIb Isoform 2, COX VIb-2, Cytochrome C Oxidase Subunit VIb, Testis-specific Isoform)
Sign In for Pricing
View Details