CFAP161 Peptide - middle region
CFAP161 Peptide - middle region
Product Specifications
Product Name Alternative
C15orf26
UniProt
Q6P656
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CFAP161 Rabbit Polyclonal Antibody (orb325845) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![UBE2S Mouse Monoclonal Antibody [Clone ID: AT2C12]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc42c/imageurl/am09138pu-n.webp)
AM09138PU-N 100 µL
UBE2S Mouse Monoclonal Antibody [Clone ID: AT2C12]
Sign In for Pricing
View Details 
E-CL-H0816-01 24 Tests
Human UBE3A (Ubiquitin Protein Ligase E3A) CLIA Kit
Sign In for Pricing
View Details E-CL-H0816-02 48 Tests
Human UBE3A (Ubiquitin Protein Ligase E3A) CLIA Kit
Sign In for Pricing
View Details E-CL-H0816-03 96 Tests
Human UBE3A (Ubiquitin Protein Ligase E3A) CLIA Kit
Sign In for Pricing
View Details 
LC422668 20 µg
APPBP1 (NAE1) (NM_001018160) Human Over-expression Lysate
Sign In for Pricing
View Details ![ASCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]](https://cdn.genprice.uk/products/937/6868c34e994c49e6dc3f3cb0/imageurl/ta503721am.webp)
TA503721AM 100 µL
ASCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]
Sign In for Pricing
View Details