CFAP161 Peptide - middle region
CFAP161 Peptide - middle region
Product Specifications
Product Name Alternative
C15orf26
UniProt
Q6P656
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CFAP161 Rabbit Polyclonal Antibody (orb325845) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![AF/LE Purified Anti-Human CD279/PD-1 Antibody[J110]](https://cdn.genprice.uk/products/763/68dd14c4061270361e7d711b/imageurl08/e-ab-f12130.webp)
E-AB-F12130-01 100 µg
AF/LE Purified Anti-Human CD279/PD-1 Antibody[J110]
Sign In for Pricing
View Details E-AB-F12130-02 1 mg
AF/LE Purified Anti-Human CD279/PD-1 Antibody[J110]
Sign In for Pricing
View Details E-AB-F12130-03 5 mg
AF/LE Purified Anti-Human CD279/PD-1 Antibody[J110]
Sign In for Pricing
View Details E-AB-F12130-04 25 mg
AF/LE Purified Anti-Human CD279/PD-1 Antibody[J110]
Sign In for Pricing
View Details E-AB-F12130-05 50 mg
AF/LE Purified Anti-Human CD279/PD-1 Antibody[J110]
Sign In for Pricing
View Details E-AB-F12130-06 100 mg
AF/LE Purified Anti-Human CD279/PD-1 Antibody[J110]
Sign In for Pricing
View Details