ACSF3 Peptide - C-terminal region
ACSF3 Peptide - C-terminal region
Product Specifications
UniProt
F5H5A1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACSF3 Rabbit Polyclonal Antibody (orb582026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTGGYKVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1819-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![SMT3 Mouse Monoclonal Antibody [Clone ID: 4F2.F5.G2]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc351/imageurl/am08436pu-n.webp)
AM08436PU-N 100 µg
SMT3 Mouse Monoclonal Antibody [Clone ID: 4F2.F5.G2]
Sign In for Pricing
View Details ![Bone marrow stromal cell antigen 1 (BST1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]](https://cdn.genprice.uk/products/937/6868c40b994c49e6dc4057c5/imageurl/ta812180bm.webp)
TA812180BM 100 µL
Bone marrow stromal cell antigen 1 (BST1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]
Sign In for Pricing
View Details 