ACSF3 Peptide - C-terminal region
ACSF3 Peptide - C-terminal region
Product Specifications
UniProt
F5H5A1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACSF3 Rabbit Polyclonal Antibody (orb582026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTGGYKVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743080-500 1x 500 µL
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3080), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
