Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP5 Peptide - C-terminal region

AQP5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AQP-5

UniProt

P55064

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AQP5 Rabbit Polyclonal Antibody (orb582140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001642

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS25 Human Gene Knockout Kit (CRISPR)
KN402487 1 Kit

VPS25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Itgam Antibody
RC-3091-01 50 μL

Recombinant Itgam Antibody

Sign In for Pricing
View Details
Recombinant Itgam Antibody
RC-3091-02 100 µL

Recombinant Itgam Antibody

Sign In for Pricing
View Details
Recombinant Itgam Antibody
RC-3091-03 1 mL

Recombinant Itgam Antibody

Sign In for Pricing
View Details
PTGDR Polyclonal Antibody
E-AB-65975-01 60 µL

PTGDR Polyclonal Antibody

Sign In for Pricing
View Details
PTGDR Polyclonal Antibody
E-AB-65975-02 120 µL

PTGDR Polyclonal Antibody

Sign In for Pricing
View Details