Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP5 Peptide - C-terminal region

AQP5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AQP-5

UniProt

P55064

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AQP5 Rabbit Polyclonal Antibody (orb582140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001642

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH (PLA2G7) Rabbit Polyclonal Antibody
TA380002 100 µL

PAFAH (PLA2G7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD300 (CD300LF) (N-term) Rabbit Polyclonal Antibody
AP50968PU-N 400 µL

CD300 (CD300LF) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HAT1 Rabbit Polyclonal Antibody
TA370307 100 µL

HAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WAPL Antibody
KC-18351-01 50 μL

WAPL Antibody

Sign In for Pricing
View Details
WAPL Antibody
KC-18351-02 100 µL

WAPL Antibody

Sign In for Pricing
View Details
WAPL Antibody
KC-18351-03 1 mL

WAPL Antibody

Sign In for Pricing
View Details