Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC5 Peptide - N-terminal region

ERCC5 Peptide - N-terminal region

Product Specifications

UniProt

P28715

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC5 Rabbit Polyclonal Antibody (orb582270) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79b (B-Cell Marker) (IGB/1843), CF488A conjugate, 0.1mg/mL
BNC881843-500 1x 500 µL

CD79b (B-Cell Marker) (IGB/1843), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
n-Undecanoyl Chloride
TRC-U788870-500MG 500 mg

n-Undecanoyl Chloride

Sign In for Pricing
View Details
Human PRAMEF14 activation kit by CRISPRa
GA119015 1 Kit

Human PRAMEF14 activation kit by CRISPRa

Sign In for Pricing
View Details
CHRNB4 Human Gene Knockout Kit (CRISPR)
KN418853 1 Kit

CHRNB4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5,12-Dihydroquinoxalino[2,3-b]quinoxaline (~90%)
TRC-D451743-5MG 5 mg

5,12-Dihydroquinoxalino[2,3-b]quinoxaline (~90%)

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), 0.2mg/mL
BNUB0010-500 1x 500 µL

MART-1 / Melan-A (M2-9E3), 0.2mg/mL

Sign In for Pricing
View Details