Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP2 Peptide - middle region

ARFIP2 Peptide - middle region

Product Specifications

UniProt

P53365

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFIP2 Rabbit Polyclonal Antibody (orb582340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REEP1 Rabbit Polyclonal Antibody (HRP)
orb470152 100 µL

REEP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal CDKL4 Antibody [DyLight 594]
NBP2-97193DL594 0.1 mL

Rabbit Polyclonal CDKL4 Antibody [DyLight 594]

Sign In for Pricing
View Details
Z-Ala-Ala-OH
sc-286870A 5 g

Z-Ala-Ala-OH

Sign In for Pricing
View Details
[Cys (Acm) 20,31]-EGF (20-31) peptide
orb70086 5 mg

[Cys (Acm) 20,31]-EGF (20-31) peptide

Sign In for Pricing
View Details
Rabbit Monoclonal CRELD1 Antibody (116) [Alexa Fluor 594]
NBP2-90218AF594 0.1 mL

Rabbit Monoclonal CRELD1 Antibody (116) [Alexa Fluor 594]

Sign In for Pricing
View Details
SMAD1 3'UTR GFP Stable Cell Line
TU073692 1.0 mL

SMAD1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details