ARHGAP45 Peptide - N-terminal region
ARHGAP45 Peptide - N-terminal region
Product Specifications
Product Name Alternative
HA-1, HMHA1, HLA-HA1
UniProt
K7ES92
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARHGAP45 Rabbit Polyclonal Antibody (orb330786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001269263.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040096-100 1x 100 µL
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040029-500 1x 500 µL
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882146-100 1x 100 µL
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042136-100 1x 100 µL
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681171-100 1x 100 µL
CD34 (HPCA1/1171), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740142-500 1x 500 µL
Beta-2 Microglobulin (B2M) (BBM.1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details