Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHX4 Peptide - C-terminal region

EPHX4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABHD7, EPHXRP

UniProt

Q8IUS5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHX4 Rabbit Polyclonal Antibody (orb326018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775838

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLTTEDLEAYIYVFSQPGALSGPINHYRNIFSCLPLKHHMVTTPTLLLWG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ficolin-1/Ficolin-A/FCN1 Protein (His Tag)
PKSH031350 100 µg

Recombinant Human Ficolin-1/Ficolin-A/FCN1 Protein (His Tag)

Sign In for Pricing
View Details
Shugoshin (SGO1) (NM_001012413) Human Over-expression Lysate
LY422851 100 µg

Shugoshin (SGO1) (NM_001012413) Human Over-expression Lysate

Sign In for Pricing
View Details
RSU1 (NM_152724) Human Recombinant Protein
TP323579M 100 µg

RSU1 (NM_152724) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS703292 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Smu1 Mouse Gene Knockout Kit (CRISPR)
KN516358 1 Kit

Smu1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF488A conjugate, 0.1mg/mL
BNC882340-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details