EPHX4 Peptide - C-terminal region
EPHX4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ABHD7, EPHXRP
UniProt
Q8IUS5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EPHX4 Rabbit Polyclonal Antibody (orb326018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775838
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QLTTEDLEAYIYVFSQPGALSGPINHYRNIFSCLPLKHHMVTTPTLLLWG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Bcl G (BCL2L14) Mouse Monoclonal Antibody [Clone ID: OTI6D1]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908461/imageurl/cf808925.webp)
CF808925 100 µg
Bcl G (BCL2L14) Mouse Monoclonal Antibody [Clone ID: OTI6D1]
Sign In for Pricing
View Details 
![Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F10]](https://cdn.genprice.uk/products/937/68dd1b87061270361ea21085/imageurl/ta813027am.webp)
TA813027AM 100 µL
Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F10]
Sign In for Pricing
View Details ![Caspase 4 (CASP4) Mouse Monoclonal Antibody [Clone ID: OTI4A2]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907d6a/imageurl/cf805590.webp)
CF805590 100 µg
Caspase 4 (CASP4) Mouse Monoclonal Antibody [Clone ID: OTI4A2]
Sign In for Pricing
View Details 
TRC-T795032-1MG 1 mg
2,3,4-Trihydroxybenzylhydrazine-15N2 Oxalic Acid Salt (>90%)
Sign In for Pricing
View Details 