Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRMD3 Peptide - N-terminal region

FRMD3 Peptide - N-terminal region

Product Specifications

UniProt

A2A2Y4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FRMD3 Rabbit Polyclonal Antibody (orb582856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZD7986 1mg
A17095-1 1 mg

AZD7986 1mg

Sign In for Pricing
View Details
SRY Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C8]
TA505267AM 100 µL

SRY Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C8]

Sign In for Pricing
View Details
Heme oxygenase 1 (HO-1) Rat ELISA Kit
D9736 96 Tests

Heme oxygenase 1 (HO-1) Rat ELISA Kit

Sign In for Pricing
View Details
NPC2 (Biotin)
570454-01 50 µg

NPC2 (Biotin)

Sign In for Pricing
View Details
NPC2 (Biotin)
570454-02 100 µg

NPC2 (Biotin)

Sign In for Pricing
View Details
Olfr1495 CRISPR Activation Plasmid (m2)
sc-434497-ACT-2 20 µg

Olfr1495 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details