Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRMD3 Peptide - N-terminal region

FRMD3 Peptide - N-terminal region

Product Specifications

UniProt

A2A2Y4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FRMD3 Rabbit Polyclonal Antibody (orb582856) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ccr8 activation kit by CRISPRa
GA200778 1 Kit

Mouse Ccr8 activation kit by CRISPRa

Sign In for Pricing
View Details
TMEM132D 3'UTR GFP Stable Cell Line
TU075838 1.0 mL

TMEM132D 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Neprilysin (NEP) Recombinant, Human
156041-01 10 µg

Neprilysin (NEP) Recombinant, Human

Sign In for Pricing
View Details
Neprilysin (NEP) Recombinant, Human
156041-02 50 µg

Neprilysin (NEP) Recombinant, Human

Sign In for Pricing
View Details
Neprilysin (NEP) Recombinant, Human
156041-03 200 µg

Neprilysin (NEP) Recombinant, Human

Sign In for Pricing
View Details
4-Iodoaniline
FI45161 500 g

4-Iodoaniline

Sign In for Pricing
View Details