GAS2L3 Peptide - N-terminal region
GAS2L3 Peptide - N-terminal region
Product Specifications
UniProt
G3V1N3
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GAS2L3 Rabbit Polyclonal Antibody (orb582858) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGDKIL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041731-100 1x 100 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400500-100 1x 100 µL
Progesterone Receptor (PR500), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401147-500 1x 500 µL
CD45RB (PTPRC/1147), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details