Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC1 Peptide - N-terminal region

ERCC1 Peptide - N-terminal region

Product Specifications

UniProt

K7ER60

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC1 Rabbit Polyclonal Antibody (orb582948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC068157 siRNA (m)
sc-141656 10 µM

BC068157 siRNA (m)

Sign In for Pricing
View Details
DNAJC12 Rabbit Polyclonal Antibody
orb588251 100 µL

DNAJC12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
JAK2 Rabbit Polyclonal Antibody
TA377647 100 µL

JAK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZDHHC21 (NM_178566) Human Untagged Clone
SC107238 10 µg

ZDHHC21 (NM_178566) Human Untagged Clone

Sign In for Pricing
View Details
Sheep AT rich interactive domain containing protein 1A (ARID1A) ELISA kit
GTR10409741 96 Well

Sheep AT rich interactive domain containing protein 1A (ARID1A) ELISA kit

Sign In for Pricing
View Details
Caspase 7 (CASP7) Mouse anti-Human Monoclonal (25B881.1) Antibody
GWB-23A9D1 0.05 mg

Caspase 7 (CASP7) Mouse anti-Human Monoclonal (25B881.1) Antibody

Sign In for Pricing
View Details