Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC1 Peptide - N-terminal region

ERCC1 Peptide - N-terminal region

Product Specifications

UniProt

K7ER60

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERCC1 Rabbit Polyclonal Antibody (orb582948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDRKH Rabbit pAb
E45R26830N 50 ul

TDRKH Rabbit pAb

Sign In for Pricing
View Details
RHOAA Antibody, Biotin Conjugated
MBS7113645-01 0.05 mg

RHOAA Antibody, Biotin Conjugated

Sign In for Pricing
View Details
RHOAA Antibody, Biotin Conjugated
MBS7113645-02 0.1 mg

RHOAA Antibody, Biotin Conjugated

Sign In for Pricing
View Details
RHOAA Antibody, Biotin Conjugated
MBS7113645-03 5x 0.1 mg

RHOAA Antibody, Biotin Conjugated

Sign In for Pricing
View Details
TMEM134 (Transmembrane Protein 134) (MaxLight 750) discontinued
134504-ML750 100 µL

TMEM134 (Transmembrane Protein 134) (MaxLight 750) discontinued

Sign In for Pricing
View Details
DOT1L ligand-1
T207203-01 10 mg

DOT1L ligand-1

Sign In for Pricing
View Details