ERCC1 Peptide - N-terminal region
ERCC1 Peptide - N-terminal region
Product Specifications
UniProt
K7ER60
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ERCC1 Rabbit Polyclonal Antibody (orb582948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2055692-01 0.1 mL
HRP-Linked Polyclonal Antibody to Mannose Binding Lectin (MBL)
Sign In for Pricing
View Details MBS2055692-02 0.2 mL
HRP-Linked Polyclonal Antibody to Mannose Binding Lectin (MBL)
Sign In for Pricing
View Details MBS2055692-03 0.5 mL
HRP-Linked Polyclonal Antibody to Mannose Binding Lectin (MBL)
Sign In for Pricing
View Details MBS2055692-04 1 mL
HRP-Linked Polyclonal Antibody to Mannose Binding Lectin (MBL)
Sign In for Pricing
View Details MBS2055692-05 5 mL
HRP-Linked Polyclonal Antibody to Mannose Binding Lectin (MBL)
Sign In for Pricing
View Details