PPOX Peptide - C-terminal region
PPOX Peptide - C-terminal region
Product Specifications
UniProt
D3DVG2
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPOX Rabbit Polyclonal Antibody (orb582997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ICH1055-100mg 100 mg
Anti-Mouse CD28 (37.51) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 
RDR-GSTa5-Hu-01 96 Tests
Human Glutathione S Transferase Alpha 5 (GSTa5) ELISA Kit
Sign In for Pricing
View Details RDR-GSTa5-Hu-02 48 Tests
Human Glutathione S Transferase Alpha 5 (GSTa5) ELISA Kit
Sign In for Pricing
View Details 
#92295 1 Kit
Mix-n-StainTM FITC Antibody Labeling Kit, 1x (20-50ug) labeling
Sign In for Pricing
View Details 
LC401108 20 µg
mtTFA (TFAM) (NM_003201) Human Over-expression Lysate
Sign In for Pricing
View Details