Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPOX Peptide - C-terminal region

PPOX Peptide - C-terminal region

Product Specifications

UniProt

D3DVG2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPOX Rabbit Polyclonal Antibody (orb582997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tide Fluor™ 3 amine [TF3 amine] *Superior replacement for Cy3*
2269-AAT 1 mg

Tide Fluor™ 3 amine [TF3 amine] *Superior replacement for Cy3*

Sign In for Pricing
View Details
Human ITPRIPL2 activation kit by CRISPRa
GA116039 1 Kit

Human ITPRIPL2 activation kit by CRISPRa

Sign In for Pricing
View Details
LRRC2 Polyclonal Antibody
E-AB-52349-01 20 µL

LRRC2 Polyclonal Antibody

Sign In for Pricing
View Details
LRRC2 Polyclonal Antibody
E-AB-52349-02 60 µL

LRRC2 Polyclonal Antibody

Sign In for Pricing
View Details
LRRC2 Polyclonal Antibody
E-AB-52349-03 120 µL

LRRC2 Polyclonal Antibody

Sign In for Pricing
View Details
LRRC2 Polyclonal Antibody
E-AB-52349-04 200 µL

LRRC2 Polyclonal Antibody

Sign In for Pricing
View Details