PDE6A Peptide - N-terminal region
PDE6A Peptide - N-terminal region
Product Specifications
UniProt
F1T0K3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDE6A Rabbit Polyclonal Antibody (orb583006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YRTRNGIAELATRLFNVHKDAVLEDCLVMPDQEIVFPLDMGIVGHVAHSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY401642 100 µg
H3.3B (H3F3B) (NM_005324) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRC-I156091-500MG 500 mg
1-Isopropylpyrimidine-2,4,6(1h,3h,5h)-trione
Sign In for Pricing
View Details 
