PDE6A Peptide - N-terminal region
PDE6A Peptide - N-terminal region
Product Specifications
UniProt
F1T0K3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDE6A Rabbit Polyclonal Antibody (orb583006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YRTRNGIAELATRLFNVHKDAVLEDCLVMPDQEIVFPLDMGIVGHVAHSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![IGF1 Mouse Monoclonal Antibody [Clone ID: OTI4B12]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907da9/imageurl/cf805748.webp)
