Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D25 Peptide - C-terminal region

TBC1D25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TBC1D25

UniProt

Q3MII6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D25 Rabbit Polyclonal Antibody (orb326096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002527

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STFEDAVDHLATASQGPGGGGRLLRQASLDGLQQLRDNMGSRRDPLVQLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KIF5A knockdown cell line
ABC-KD7917 1 Vial

Human KIF5A knockdown cell line

Sign In for Pricing
View Details
Anti-Myocilin  (2B4)
YF-MA14364 100 ug

Anti-Myocilin (2B4)

Sign In for Pricing
View Details
(1R,2R) -2-PCCA (hydrochloride) 10mg
A21655-10 10 mg

(1R,2R) -2-PCCA (hydrochloride) 10mg

Sign In for Pricing
View Details
CFAP298 CRISPR Activation Plasmid (h)
sc-408922-ACT 20 µg

CFAP298 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
EIF4A2 (NM_001967) Human Tagged ORF Clone Lentiviral Particle
RC205623L1V 200 µL

EIF4A2 (NM_001967) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Acetate non-utilizing protein 9, mitochondrial (ACN9)
MBS1200545-01 0.05 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Acetate non-utilizing protein 9, mitochondrial (ACN9)

Sign In for Pricing
View Details