PPP2R1A Peptide - N-terminal region
PPP2R1A Peptide - N-terminal region
Product Specifications
Product Name Alternative
PPP2R1A
UniProt
A8K7B7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP2R1A Rabbit Polyclonal Antibody (orb583710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055040
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-2401-A-5 1 mL
Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-A4 -, 5nm
Sign In for Pricing
View Details 
#92514 1 Kit
Mix-n-StainTM CF®680R Nanobody Labeling Kit, 1x (5-20ug) labeling
Sign In for Pricing
View Details 
PKSH032567-01 10 µg
Recombinant Human IL15RA&IL15 Fusion Protein (Fc Tag)
Sign In for Pricing
View Details PKSH032567-02 50 µg
Recombinant Human IL15RA&IL15 Fusion Protein (Fc Tag)
Sign In for Pricing
View Details 