PPP2R1A Peptide - N-terminal region
PPP2R1A Peptide - N-terminal region
Product Specifications
Product Name Alternative
PPP2R1A
UniProt
A8K7B7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP2R1A Rabbit Polyclonal Antibody (orb583710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055040
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ERCC1 Mouse Monoclonal Antibody [Clone ID: OTI15F10]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907ddc/imageurl/cf805854.webp)
CF805854 100 µg
ERCC1 Mouse Monoclonal Antibody [Clone ID: OTI15F10]
Sign In for Pricing
View Details 
BNUM1827-50 1x 50 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), 1mg/mL
Sign In for Pricing
View Details 
BNUM3803-50 1x 50 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), 1mg/mL
Sign In for Pricing
View Details