Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCKDHB Peptide - N-terminal region

BCKDHB Peptide - N-terminal region

Product Specifications

UniProt

Q5T2J3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCKDHB Rabbit Polyclonal Antibody (orb584052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFLHPAATVEDAAQRRQVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC5A/MDL1 Human Monoclonal Antibody (FITC)
orb2973439-01 50 Tests

CLEC5A/MDL1 Human Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
CLEC5A/MDL1 Human Monoclonal Antibody (FITC)
orb2973439-02 100 Tests

CLEC5A/MDL1 Human Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
In vivo Grade Recombinant Anti-mouse CD25 Mouse IgG2c Kappa Monoclonal Antibody
TBS10226-1 1 mg

In vivo Grade Recombinant Anti-mouse CD25 Mouse IgG2c Kappa Monoclonal Antibody

Sign In for Pricing
View Details
MYEF2 ELISA Kit (Human) (OKWB00199)
OKWB00199 96 Well

MYEF2 ELISA Kit (Human) (OKWB00199)

Sign In for Pricing
View Details
SMARCD1 Antibody (YA1321, Rabbit)
HY-P81576 1 Each

SMARCD1 Antibody (YA1321, Rabbit)

Sign In for Pricing
View Details
Human β2-microglobulin (BMG,β2-MG) Elisa Kit
EK710837 96 Well

Human β2-microglobulin (BMG,β2-MG) Elisa Kit

Sign In for Pricing
View Details