Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMTN Peptide - C-terminal region

DMTN Peptide - C-terminal region

Product Specifications

UniProt

Q08495

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMTN Rabbit Polyclonal Antibody (orb584086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS707342 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
IFluor® 800 acid
1375-AAT 1 mg

IFluor® 800 acid

Sign In for Pricing
View Details
Anks6 Mouse Gene Knockout Kit (CRISPR)
KN501310 1 Kit

Anks6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB31 Goat Polyclonal Antibody
AB0068-200 600 µg

RAB31 Goat Polyclonal Antibody

Sign In for Pricing
View Details
MDM2 (SMP14), CF405S conjugate, 0.1mg/mL
BNC041721-500 1x 500 µL

MDM2 (SMP14), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ESD Rabbit Polyclonal Antibody
R1511-9 100 µL

ESD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details