DMTN Peptide - C-terminal region
DMTN Peptide - C-terminal region
Product Specifications
UniProt
Q08495
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DMTN Rabbit Polyclonal Antibody (orb584086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881527-500 1x 500 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940409-100 1x 100 µL
UPK3A (Uroplakin 3A) (Rabbit PAb), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![4-Chloro-6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidine](https://cdn.genprice.uk/products/572/7519515264333/imageurl/trc-c365370-250mg.webp)
TRC-C365370-250MG 250 mg
4-Chloro-6,7-dihydro-5H-pyrrolo[2,3-d]pyrimidine
Sign In for Pricing
View Details