Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABARAPL1 Peptide - middle region

GABARAPL1 Peptide - middle region

Product Specifications

UniProt

Q9H0R8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GABARAPL1 Rabbit Polyclonal Antibody (orb584157) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CFL1 (Cofilin 1, Non Muscle) ELISA Kit
ELK2067-01 48 Tests

Human CFL1 (Cofilin 1, Non Muscle) ELISA Kit

Sign In for Pricing
View Details
Human CFL1 (Cofilin 1, Non Muscle) ELISA Kit
ELK2067-02 96 Tests

Human CFL1 (Cofilin 1, Non Muscle) ELISA Kit

Sign In for Pricing
View Details
Human CFL1 (Cofilin 1, Non Muscle) ELISA Kit
ELK2067-03 5x 96 Tests

Human CFL1 (Cofilin 1, Non Muscle) ELISA Kit

Sign In for Pricing
View Details
pCMV-SPORT6.ccdb-Lrp10 Plasmid
PVT40574 2 µg

pCMV-SPORT6.ccdb-Lrp10 Plasmid

Sign In for Pricing
View Details
UHRF1BP1 Protein Vector (Mouse) (pPM-C-HA)
PV244092 500 ng

UHRF1BP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PYCR2, ID (PYCR2, Pyrroline-5-carboxylate reductase 2) (MaxLight 490)
MBS6339344-01 0.1 mL

PYCR2, ID (PYCR2, Pyrroline-5-carboxylate reductase 2) (MaxLight 490)

Sign In for Pricing
View Details