Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS18C Peptide - C-terminal region

MRPS18C Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRP-S18-1, MRPS18-1

UniProt

Q9Y3D5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS18C Rabbit Polyclonal Antibody (orb587544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057151

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COQ5 activation kit by CRISPRa
GA113471 1 Kit

Human COQ5 activation kit by CRISPRa

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (MACIF/629), CF488A conjugate, 0.1mg/mL
BNC880629-100 1x 100 µL

CD59 (heavy chain of Protectin) (MACIF/629), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Palladium Black 99.9%
TRC-P141070-500MG 500 mg

Palladium Black 99.9%

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS806457 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Tefluthrin
TRC-T013800-5G 5 g

Tefluthrin

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), CF740 conjugate, 0.1mg/mL
BNC741746-100 1x 100 µL

Human Herpes Virus 8 (HHV8) (LN53), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details