Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS18C Peptide - C-terminal region

MRPS18C Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRP-S18-1, MRPS18-1

UniProt

Q9Y3D5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS18C Rabbit Polyclonal Antibody (orb587544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057151

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefacetrile
TRC-C231500-5MG 5 mg

Cefacetrile

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS623447 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Rps6ka4 Mouse Gene Knockout Kit (CRISPR)
KN515110 1 Kit

Rps6ka4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant MAPKAP Kinase 2 Antibody
RC-15807-01 50 μL

Recombinant MAPKAP Kinase 2 Antibody

Sign In for Pricing
View Details
Recombinant MAPKAP Kinase 2 Antibody
RC-15807-02 100 µL

Recombinant MAPKAP Kinase 2 Antibody

Sign In for Pricing
View Details
Recombinant MAPKAP Kinase 2 Antibody
RC-15807-03 1 mL

Recombinant MAPKAP Kinase 2 Antibody

Sign In for Pricing
View Details