Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF11 Peptide - middle region

NBPF11 Peptide - middle region

Product Specifications

UniProt

Q86T75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NBPF11 Rabbit Polyclonal Antibody (orb587561) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLAKQQNKYKYEECKDLIKSMLRNERQFKEEKLAEQLKQAEELRQYKVLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL17RA (Brodalumab)-MC-Vc-PAB-SN38 ADC
ADC-W-1320 1 mg

Anti-IL17RA (Brodalumab)-MC-Vc-PAB-SN38 ADC

Sign In for Pricing
View Details
Human Metallothionein-2 (MT2A)
CSB-RP173544h-01 10 µg

Human Metallothionein-2 (MT2A)

Sign In for Pricing
View Details
Human Metallothionein-2 (MT2A)
CSB-RP173544h-02 50 µg

Human Metallothionein-2 (MT2A)

Sign In for Pricing
View Details
Human Metallothionein-2 (MT2A)
CSB-RP173544h-03 100 µg

Human Metallothionein-2 (MT2A)

Sign In for Pricing
View Details
Human Metallothionein-2 (MT2A)
CSB-RP173544h-04 200 µg

Human Metallothionein-2 (MT2A)

Sign In for Pricing
View Details
Human Metallothionein-2 (MT2A)
CSB-RP173544h-05 500 µg

Human Metallothionein-2 (MT2A)

Sign In for Pricing
View Details