Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5J2 Peptide - C-terminal region

OR5J2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-266

UniProt

Q8NH18

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5J2 Rabbit Polyclonal Antibody (orb587619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005492

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSYIQPSSQYFVEQEKVVSMFYTLGIPMLNLLIHSLRNKDVKEAVKRAIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human STAR Protein (Trx Tag)
PDEH100616-01 20 µg

Recombinant Human STAR Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human STAR Protein (Trx Tag)
PDEH100616-02 100 µg

Recombinant Human STAR Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human STAR Protein (Trx Tag)
PDEH100616-03 500 µg

Recombinant Human STAR Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human STAR Protein (Trx Tag)
PDEH100616-04 1 mg

Recombinant Human STAR Protein (Trx Tag)

Sign In for Pricing
View Details
Nemadectin
TRC-N389790-5MG 5 mg

Nemadectin

Sign In for Pricing
View Details
Tissue FFPE Sections, Testis
CS803672 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details