Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5J2 Peptide - C-terminal region

OR5J2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-266

UniProt

Q8NH18

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5J2 Rabbit Polyclonal Antibody (orb587619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005492

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSYIQPSSQYFVEQEKVVSMFYTLGIPMLNLLIHSLRNKDVKEAVKRAIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KIRREL1 activation kit by CRISPRa
GA110636 1 Kit

Human KIRREL1 activation kit by CRISPRa

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), Biotin conjugate, 0.1mg/mL
BNCB2430-100 1x 100 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Galanin/GAL Protein (Fc Tag)
PKSH031133 100 µg

Recombinant Human Galanin/GAL Protein (Fc Tag)

Sign In for Pricing
View Details
Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit
E-CL-H0902-01 24 Tests

Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit

Sign In for Pricing
View Details
Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit
E-CL-H0902-02 48 Tests

Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit

Sign In for Pricing
View Details
Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit
E-CL-H0902-03 96 Tests

Human NF-κB p65 (Nuclear Factor Kappa B p65) CLIA Kit

Sign In for Pricing
View Details