OR5K2 Peptide - middle region
OR5K2 Peptide - middle region
Product Specifications
Product Name Alternative
OR3-9
UniProt
Q8NHB8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR5K2 Rabbit Polyclonal Antibody (orb587620) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004737
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILLTIFRMKSKEGRAKAFSTCASHFSSVSLFYGSIFFLYIRPNLLEEGGN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#31045-20mL 2x 10 mL
Forget-Me-NotTM EvaGreen® qPCR Master Mix (Low ROX) (2000 reactions)
Sign In for Pricing
View Details 
BNC471171-500 1x 500 µL
CD34 (HPCA1/1171), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![IFI35 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G5]](https://cdn.genprice.uk/products/937/6868c34d994c49e6dc3f389b/imageurl/ta503360bm.webp)
TA503360BM 100 µL
IFI35 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G5]
Sign In for Pricing
View Details 