Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5K2 Peptide - middle region

OR5K2 Peptide - middle region

Product Specifications

Product Name Alternative

OR3-9

UniProt

Q8NHB8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5K2 Rabbit Polyclonal Antibody (orb587620) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004737

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILLTIFRMKSKEGRAKAFSTCASHFSSVSLFYGSIFFLYIRPNLLEEGGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPMT Mouse Monoclonal Antibody [Clone ID: AT2E7]
AM09399PU-N 100 µL

TPMT Mouse Monoclonal Antibody [Clone ID: AT2E7]

Sign In for Pricing
View Details
MEK1 (Ab-286) Antibody
8B0681-AAT 50 µg

MEK1 (Ab-286) Antibody

Sign In for Pricing
View Details
rac-1-Stearoyl-3-chloropropanediol
TRC-S686525-250MG 250 mg

rac-1-Stearoyl-3-chloropropanediol

Sign In for Pricing
View Details
Cbr1 Mouse Gene Knockout Kit (CRISPR)
KN502603 1 Kit

Cbr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
F4/80 Recombinant Rabbit monoclonal Antibody
HA750665 100 µL

F4/80 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
7-Keto Cholesterol (~98%)
TRC-K185050-5MG 5 mg

7-Keto Cholesterol (~98%)

Sign In for Pricing
View Details