Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5K4 Peptide - C-terminal region

OR5K4 Peptide - C-terminal region

Product Specifications

UniProt

A6NMS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5K4 Rabbit Polyclonal Antibody (orb587621) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005517

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYIFSIPIQIFTIATVLISYLCILLTVFKMKSKEGRGKAFSTCASHFLSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Napsin A Antibody (NAPSA/3309) [PE]
NBP3-08369PE 0.1 mL

Mouse Monoclonal Napsin A Antibody (NAPSA/3309) [PE]

Sign In for Pricing
View Details
STF1 Antibody
orb2808209 100 µL

STF1 Antibody

Sign In for Pricing
View Details
Cela1 Mouse Gene Knockout Kit (CRISPR)
KN503110 1 Kit

Cela1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF192 AAV siRNA Pooled Vector
51338161 1.0 µg

ZNF192 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lornoxicam
B1441-100 100 mg

Lornoxicam

Sign In for Pricing
View Details
Calpain 1 (CAPN1) Rabbit Polyclonal Antibody
TA361252 100 µL

Calpain 1 (CAPN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details