Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5K4 Peptide - C-terminal region

OR5K4 Peptide - C-terminal region

Product Specifications

UniProt

A6NMS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5K4 Rabbit Polyclonal Antibody (orb587621) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005517

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYIFSIPIQIFTIATVLISYLCILLTVFKMKSKEGRGKAFSTCASHFLSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Arginase II (ARG2)
FY-AB40624-01 1 mL

Anti-Arginase II (ARG2)

Sign In for Pricing
View Details
Anti-Arginase II (ARG2)
FY-AB40624-02 100 µL

Anti-Arginase II (ARG2)

Sign In for Pricing
View Details
Anti-Arginase II (ARG2)
FY-AB40624-03 200 µL

Anti-Arginase II (ARG2)

Sign In for Pricing
View Details
PCIA1, ID (DDA1, C19orf58, PCIA1, DET1-and DDB1-associated protein 1, Placenta cross-immune reaction antigen 1) (FITC)
MBS6331784-01 0.2 mL

PCIA1, ID (DDA1, C19orf58, PCIA1, DET1-and DDB1-associated protein 1, Placenta cross-immune reaction antigen 1) (FITC)

Sign In for Pricing
View Details
PCIA1, ID (DDA1, C19orf58, PCIA1, DET1-and DDB1-associated protein 1, Placenta cross-immune reaction antigen 1) (FITC)
MBS6331784-02 5x 0.2 mL

PCIA1, ID (DDA1, C19orf58, PCIA1, DET1-and DDB1-associated protein 1, Placenta cross-immune reaction antigen 1) (FITC)

Sign In for Pricing
View Details
NEK8 Protein Vector (Rat) (pPB-N-His)
PV284907 500 ng

NEK8 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details