Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5L2 Peptide - C-terminal region

OR5L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSHTPCRX16, HTPCRX16, OR11-153

UniProt

Q8NGL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5L2 Rabbit Polyclonal Antibody (orb587623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004739

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YCRPSSGNSGDVDKVATVFYTVVIPMLNPLIYSLRNKDVNKALRKVMGSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SHOX knockdown cell line
ABC-KD13768 1 Vial

Human SHOX knockdown cell line

Sign In for Pricing
View Details
Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit
MBS731554-01 48 Strip Well (Competitive)

Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit
MBS731554-02 48 Strip Well (Sandwich)

Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit
MBS731554-03 96 Strip Well (Competitive)

Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit
MBS731554-04 96 Strip Well (Sandwich)

Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit
MBS731554-05 5x 96 Strip Well (Competitive)

Guinea Pig Transforming Growth Factor Beta 3 ELISA Kit

Sign In for Pricing
View Details